PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009563m
Common NameCARUB_v10009563mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 357aa    MW: 40156.4 Da    PI: 5.6457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009563mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ + +++G g W+t +++ g++R++k+c++rw +yl
  Carubv10009563m 15 KGAWTPEEDQKLLSYLNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62
                     79********************************************97 PP

2Myb_DNA-binding51.52.4e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T +E+  ++ +++++G++ W++Iar ++ gRt++++k++w+++
  Carubv10009563m  68 RGEFTDDEERSIISLHALHGNK-WSAIARGLP-GRTDNEIKNYWNTH 112
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7861062IPR017930Myb domain
SuperFamilySSF466891.57E-2812109IPR009057Homeodomain-like
SMARTSM007177.6E-131464IPR001005SANT/Myb domain
PfamPF002491.3E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-231669IPR009057Homeodomain-like
CDDcd001671.69E-91762No hitNo description
PROSITE profilePS5129424.98863117IPR017930Myb domain
SMARTSM007178.8E-1667115IPR001005SANT/Myb domain
PfamPF002497.9E-1568112IPR001005SANT/Myb domain
CDDcd001672.15E-1170113No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2570118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009625Biological Processresponse to insect
GO:0009651Biological Processresponse to salt stress
GO:0009682Biological Processinduced systemic resistance
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009759Biological Processindole glucosinolate biosynthetic process
GO:0052544Biological Processdefense response by callose deposition in cell wall
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MVRTPCCKAE LGLKKGAWTP EEDQKLLSYL NRHGEGGWRT LPEKAGLKRC GKSCRLRWAN  60
YLRPDIKRGE FTDDEERSII SLHALHGNKW SAIARGLPGR TDNEIKNYWN THIKKRLIKK  120
GIDPVTHKDL NAGTDKSENH PDEQNVNQTS SDDDVLDNEK PKKNNKNRRL PSARFLNRVA  180
NRFGKRINHS VLSEIIGSGG PLASCHTTTT TTTTSVSVDS EQDKSTSSSF TPTSNLLCQA  240
AVNATTPVSS YFDVDGYVNP TSSSSTFSDS SVNNPPMYCD NFVGNNNIDD EDTIGFSTFL  300
NDEDFMILEE SCVENTAFMK EITRFLHEDE RDVVEVTPVY EHERQDIYDE IDKYFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27131175108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00147DAPTransfer from AT1G18570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1173310.0AK117331.1 Arabidopsis thaliana At1g18570 mRNA for unknown protein, complete cds, clone: RAFL16-90-B03.
GenBankAY5195550.0AY519555.1 Arabidopsis thaliana MYB transcription factor (At1g18570) mRNA, complete cds.
GenBankBT0062440.0BT006244.1 Arabidopsis thaliana At1g18570 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305192.10.0hypothetical protein CARUB_v10009563mg
SwissprotO497820.0MYB51_ARATH; Transcription factor MYB51
TrEMBLR0II340.0R0II34_9BRAS; Uncharacterized protein
STRINGAT1G18570.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.10.0myb domain protein 51